PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G020200.1
Common NamePHAVU_006G020200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 526aa    MW: 58403.8 Da    PI: 4.7926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G020200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.6e-174087148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+ Ed +l+++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Phvul.006G020200.1 40 KGPWTAAEDAILLEYVNKHGQGNWNAVQKYSGLARCGKSCRLRWANHL 87
                        79******************************************9986 PP

2Myb_DNA-binding51.62.2e-1693136146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
  Phvul.006G020200.1  93 KGAFTEEEENRILELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 136
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6693587IPR017930Myb domain
SuperFamilySSF466892.08E-3037134IPR009057Homeodomain-like
SMARTSM007171.7E-143989IPR001005SANT/Myb domain
PfamPF002498.6E-164087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-244194IPR009057Homeodomain-like
CDDcd001679.64E-124287No hitNo description
PROSITE profilePS5129425.2288142IPR017930Myb domain
SMARTSM007173.9E-1692140IPR001005SANT/Myb domain
PfamPF002492.2E-1593136IPR001005SANT/Myb domain
CDDcd001675.65E-1295136No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2595140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MSSVTSGGDN RKIYRGCRSS SLDEEGEVGG NMGGEVPLKK GPWTAAEDAI LLEYVNKHGQ  60
GNWNAVQKYS GLARCGKSCR LRWANHLRPD LKKGAFTEEE ENRILELHAK MGNKWARMAA  120
ELPGRTDNEI KNYWNTRIKR MQRAGLPIYP PELCERILNA NQESQNICPL TVEASQHDNL  180
LQTDQFDIQD MDFKTVKFHH GPSQVPGILD IPENLFEQCS DSSHLFPTLY PSKRLRESEI  240
LYNSFGSCTA NALQLFDQYG NYIGEKIYDH PRFYPPFESV LNTSNQFHGD NINGSHAMLN  300
GNVSSSVPLF GARKLELPSL QYTETQHGSW VTHGSPLPSL ESVDTLIQSP PVESIPSDLI  360
SPQSSGLLEA IVYNSKSMKD SNTDLFFPVI TGASNEAAGS STLNHPYKTE WDEQGESNSP  420
LGQSAASVMT DYTPISSVDG PQSIETIQDH DDKLEALTWF PNSSWKKEKS EQIDFSQRPD  480
ALFDLAWFGS NTECGISQSD LKDALSALLG EDYKSNFGED SKGKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30381405106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146191.10.0hypothetical protein PHAVU_006G020200g
TrEMBLV7BMB00.0V7BMB0_PHAVU; Uncharacterized protein
STRINGGLYMA20G11040.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.34e-94myb domain protein 33